DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and trnt1

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_989006.1 Gene:trnt1 / 394602 XenbaseID:XB-GENE-478054 Length:405 Species:Xenopus tropicalis


Alignment Length:86 Identity:23/86 - (26%)
Similarity:30/86 - (34%) Gaps:42/86 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LRI---TEGEHLKPEFLKLNPQHTIPTLVDNGFAIWESRAIAVYLVEKYGKDDSLFPNDPQKRAL 92
            ||:   |:|.|.:.||.                ..||:                    |.::|.|
 Frog    96 LRVDVQTDGRHAEVEFT----------------TDWET--------------------DAERRDL 124

  Fly    93 -INQR-LYFDMGTLHDSFMKY 111
             ||.. |.|| |||:|.|..|
 Frog   125 TINSMFLGFD-GTLYDYFNGY 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 23/86 (27%)
GST_N_Delta_Epsilon 1..74 CDD:239343 9/45 (20%)
GST_C_Delta_Epsilon 88..204 CDD:198287 13/26 (50%)
trnt1NP_989006.1 PcnB 11..405 CDD:223690 23/86 (27%)
NT_ClassII-CCAase 13..149 CDD:143388 23/86 (27%)
PolyA_pol_RNAbd 190..241 CDD:289399
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.