DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and gstt1b

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_956878.1 Gene:gstt1b / 393556 ZFINID:ZDB-GENE-040426-1491 Length:242 Species:Danio rerio


Alignment Length:228 Identity:61/228 - (26%)
Similarity:106/228 - (46%) Gaps:29/228 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFYYSPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWES 65
            ::.|....|...|::.:.||...::.:.|::.:.||.....||.|:||....||:.|..|.:.||
Zfish     3 LEIYLDLFSQPCRSVYIFAKKNNIQFDYKKISLFEGYQYGEEFGKINPLRKFPTIKDGDFCLAES 67

  Fly    66 RAIAVYLVEKYGKDDSLFPNDPQKRALINQRLYFDMGTLHDSFMKY-----YYPFIRTGQLGNAE 125
            .||.:||.:|:...|..||.|.||||.:|:.|.:.    |.|...:     ::..:....||...
Zfish    68 VAIMIYLADKFHTPDHWFPADLQKRARVNEYLSWQ----HTSIRMHGAKIIWFKILIPEVLGAEV 128

  Fly   126 NYKKVEAAFE--------FLDIFLEGQDYVAGSQLTVAD-IAILSSVSTFEVVEFDISKYPNVAR 181
            ..:|:|.|.|        |.|.||:.:.::.|.|:::|| :||:..:..| ....|:        
Zfish   129 PKEKMENAEENLNVALQLFQDKFLQDKPFIVGDQISLADLVAIVEIMQPF-AAGMDV-------- 184

  Fly   182 WYANAKKITPGWDENWKGLLQMKTMYEAQKASL 214
             :.|..|: ..|.:..:..:..|...||.:|::
Zfish   185 -FENRPKL-KAWKDRVRVAIGAKLFDEAHQATM 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 54/196 (28%)
GST_N_Delta_Epsilon 1..74 CDD:239343 23/72 (32%)
GST_C_Delta_Epsilon 88..204 CDD:198287 29/129 (22%)
gstt1bNP_956878.1 GstA 1..199 CDD:223698 57/210 (27%)
GST_N_Theta 3..78 CDD:239348 23/74 (31%)
GST_C_Theta 91..217 CDD:198292 32/140 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.