DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and gstt2

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_956815.2 Gene:gstt2 / 393493 ZFINID:ZDB-GENE-040426-1617 Length:228 Species:Danio rerio


Alignment Length:218 Identity:56/218 - (25%)
Similarity:99/218 - (45%) Gaps:11/218 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YYSPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWESRAI 68
            |....|...|.:::..|...:....:|:.|.:||...|||.||||...:|.|.||||.:.||.||
Zfish    10 YLDLMSQPCRAVLIFLKHNKIPHTVEQIAIRKGEQKTPEFTKLNPMQKVPVLEDNGFVLTESDAI 74

  Fly    69 AVYLVEKYGKDDSLFPNDPQKRALINQ-RLYFDMGTLHDSFMKYYYPFIRTGQLGNAENYKKVEA 132
            ..||...|...|..:|..|:|||.::: ..:..|.|...:...::...:.....|...|..|:|.
Zfish    75 LKYLATTYKVPDHWYPKLPEKRARVDEYTAWHHMNTRMHAATVFWQEVLLPLMTGQPANTAKLEK 139

  Fly   133 AFEFL--------DIFLEGQDYVAGSQLTVADIAILSSVSTFEVVEFDISK-YPNVARWYANAKK 188
            |...|        ::||:.|.::.|..:::||:..:..:........||.| .|.:..|.:..:.
Zfish   140 ALSDLSGTLDKLENMFLKRQAFLCGDDISLADLLAICELMQPMSSGRDILKDRPKLLSWRSRVQS 204

  Fly   189 -ITPGWDENWKGLLQMKTMYEAQ 210
             ::..:||....:.:::..:.|:
Zfish   205 ALSDSFDEAHTIVYRLRDKFTAK 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 53/189 (28%)
GST_N_Delta_Epsilon 1..74 CDD:239343 27/69 (39%)
GST_C_Delta_Epsilon 88..204 CDD:198287 24/126 (19%)
gstt2NP_956815.2 GST_N_Theta 7..82 CDD:239348 27/71 (38%)
GST_C_Theta 95..220 CDD:198292 24/124 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589532
Domainoid 1 1.000 50 1.000 Domainoid score I11638
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.