DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and se

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster


Alignment Length:195 Identity:48/195 - (24%)
Similarity:78/195 - (40%) Gaps:44/195 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AKALGLELNKKQ-------LRITEGEHLKPEF-LKLNPQHTIPTL----VDNGFAIWESRAIAVY 71
            |:.:.|.|:.||       :.:|:    |||: |:.|||..:|.|    ......:.||..|..|
  Fly    33 AQRVHLVLDAKQIPYHSIYINLTD----KPEWLLEKNPQGKVPALEIVREPGPPVLTESLLICEY 93

  Fly    72 LVEKYGKDDSLFPNDPQKRALINQRLYFDMGTLHDSFMKYYYPFIRTGQLGNAENYKKVEAAFEF 136
            |.|:|.. ..|:|.||.|:  :..:|      |.:.|......|.:....|:.|.:      :..
  Fly    94 LDEQYPL-RPLYPRDPLKK--VQDKL------LIERFRAVLGAFFKASDGGDLEPF------WSG 143

  Fly   137 LDIF-----LEGQDYVAGSQLTVADIAI--------LSSVSTFEVVEFDISKYPNVARWYANAKK 188
            |||:     ..|.::..|.|..:.|..|        |..:...|...:|.|::|.:..|....|:
  Fly   144 LDIYERELARRGTEFFGGEQTGILDYMIWPWCERLELLKLQRGEDYNYDQSRFPQLTLWLERMKR 208

  Fly   189  188
              Fly   209  208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 47/189 (25%)
GST_N_Delta_Epsilon 1..74 CDD:239343 20/66 (30%)
GST_C_Delta_Epsilon 88..204 CDD:198287 22/114 (19%)
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 19/65 (29%)
GstA 22..215 CDD:223698 48/195 (25%)
GST_C_Omega 109..229 CDD:198293 22/114 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460125
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.