DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and GstE12

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster


Alignment Length:212 Identity:78/212 - (36%)
Similarity:123/212 - (58%) Gaps:3/212 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YYSPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWESRAI 68
            ||:..|..||.:::.|||:||:|..:.:.:.:||||.|||||||||||||||:|....|.:|.||
  Fly     7 YYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATIIDSHAI 71

  Fly    69 AVYLVEKYG-KDDSLFPNDPQKRALINQRLYFDMGTLHDSFMKYYYPFIRTGQLG-NAENYKKVE 131
            ..||||||| |:..|:|.:..:||.::.||:.|.|.|.......|.|.:..|... :.:....::
  Fly    72 CAYLVEKYGQKEQQLYPKELVQRANVDARLHLDSGHLFARLRFLYEPILYYGSTDCSIDKIAYIQ 136

  Fly   132 AAFEFLDIFLEGQDYVAGSQLTVADIAILSSV-STFEVVEFDISKYPNVARWYANAKKITPGWDE 195
            ..:|.|:.||:.|.|:.||.||:||...:::| |..:....|..|:|.:..|.....::....:.
  Fly   137 KCWEILEGFLKDQPYLCGSDLTIADFCAVATVTSVNDTAPIDEFKFPKMHAWLKRLAELPYYQEV 201

  Fly   196 NWKGLLQMKTMYEAQKA 212
            |..|..::|::::|:.|
  Fly   202 NGDGADELKSIFKAKLA 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 73/182 (40%)
GST_N_Delta_Epsilon 1..74 CDD:239343 37/69 (54%)
GST_C_Delta_Epsilon 88..204 CDD:198287 30/117 (26%)
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 37/69 (54%)
GstA 6..201 CDD:223698 73/193 (38%)
GST_C_Delta_Epsilon 92..210 CDD:198287 30/117 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460312
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.