DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and Gr59f

DIOPT Version :10

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster


Alignment Length:135 Identity:25/135 - (18%)
Similarity:45/135 - (33%) Gaps:56/135 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 NDPQKRALINQRLYFDMGTLHDSFMKYYYPFIRTGQLGNAENYKKVEAAFEFLDIFLEGQDYVAG 149
            |.|::|.              .||...|           ||.||::.....:|.:          
  Fly    13 NSPRERL--------------SSFNPQY-----------AERYKELYRTLFWLLL---------- 42

  Fly   150 SQLTVADIAILSSVSTFEVVEFDISKYPNVARWYANAKKITPGWDENWKGLLQMKTMYE-----A 209
                   |::|::.:...:    :...||  |:|   :.:...|...|.||..:.:.:|     .
  Fly    43 -------ISVLANTAPITI----LPGCPN--RFY---RLVHLSWMILWYGLFVLGSYWEFVLVTT 91

  Fly   210 QKASL 214
            |:.||
  Fly    92 QRVSL 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 GST_N_Delta_Epsilon 1..74 CDD:239343
GST_C_Delta_Epsilon 88..204 CDD:198287 19/115 (17%)
Gr59fNP_788432.1 7tm_7 61..388 CDD:473258 10/39 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.