DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and GstE11

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster


Alignment Length:204 Identity:79/204 - (38%)
Similarity:117/204 - (57%) Gaps:10/204 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YYSPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWESRAI 68
            ||:|||...|.:::.|.||||||:.:.:.:..|||...||||||.|||||.|.|||..:.:|..|
  Fly     8 YYAPRSPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIVSDSHII 72

  Fly    69 AVYLVEKYGK--DDSLFPNDPQKRALINQRLYFDMGTLHDSFMKYYYPFIRTGQLGN--AENYKK 129
            ..||.:||..  ||||:|.||:||.|::.|||:|.|.|.........|.|..| .|.  ::....
  Fly    73 CSYLADKYAPEGDDSLYPKDPEKRRLVDARLYYDCGHLFPRIRFIVEPVIYFG-AGEVPSDRVAY 136

  Fly   130 VEAAFEFLDIFLEGQDYVAGSQLTVADIAILSSVST---FEVVEFDISKYPNVARWYANAKKITP 191
            ::.|::.|:..|...||:.|.:||:||::.::||||   |..:|.|  ::|.:.:|....:.:..
  Fly   137 LQKAYDGLEHCLAEGDYLVGDKLTIADLSCIASVSTAEAFAPIEPD--QFPRLVQWVKRIQALPY 199

  Fly   192 GWDENWKGL 200
            ....|.:||
  Fly   200 YQKNNQEGL 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 76/186 (41%)
GST_N_Delta_Epsilon 1..74 CDD:239343 35/69 (51%)
GST_C_Delta_Epsilon 88..204 CDD:198287 35/118 (30%)
GstE11NP_001286575.1 GstA 5..198 CDD:223698 76/192 (40%)
GST_N_Delta_Epsilon 5..78 CDD:239343 35/69 (51%)
GST_C_Delta_Epsilon 94..211 CDD:198287 35/118 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460313
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.