DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and GstE8

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster


Alignment Length:207 Identity:76/207 - (36%)
Similarity:120/207 - (57%) Gaps:5/207 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YYSPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWESRAI 68
            |.:..|...|...:...|||:.....::.....|.|.||||:.|||||:|||.|:|..||:|.||
  Fly     7 YGTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQHTVPTLEDDGHFIWDSHAI 71

  Fly    69 AVYLVEKYGKDDSLFPNDPQKRALINQRLYFDMGTLHDSFMK-YYYPFIRTGQLG-NAENYKKVE 131
            :.|||.|||:.|:|:|.|..:||:::|||:|:.|.:..:.:: ...|...|||.. ..|.|..|.
  Fly    72 SAYLVSKYGQSDTLYPKDLLQRAVVDQRLHFESGVVFVNGLRGITKPLFATGQTTIPKERYDAVI 136

  Fly   132 AAFEFLDIFLEGQDYVAGSQLTVADIAILSSVSTFEV-VEFDISKYPNVARWYANAKKITPGWDE 195
            ..::|::.||.|.|::||.|||:||.::::|::...| |..|..||.|:..|....::: |.::|
  Fly   137 EIYDFVETFLTGHDFIAGDQLTIADFSLITSITALAVFVVIDTVKYANITAWIKRIEEL-PYYEE 200

  Fly   196 N-WKGLLQMKTM 206
            . .||...:.|:
  Fly   201 ACGKGARDLVTL 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 71/182 (39%)
GST_N_Delta_Epsilon 1..74 CDD:239343 29/69 (42%)
GST_C_Delta_Epsilon 88..204 CDD:198287 38/119 (32%)
GstE8NP_001286571.1 GstA 4..196 CDD:223698 71/189 (38%)
GST_N_Delta_Epsilon 4..77 CDD:239343 29/69 (42%)
GST_C_Delta_Epsilon 91..209 CDD:198287 38/118 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460302
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.