DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and GstE3

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster


Alignment Length:192 Identity:72/192 - (37%)
Similarity:118/192 - (61%) Gaps:17/192 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWESRAIAVYLVEKYG 77
            |::::..:||.|:.:.|.:.:.|.|||||||||:||.||:|.|.||||.:.:|.||..|||.|||
  Fly    16 RSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLADSHAINSYLVSKYG 80

  Fly    78 KDDSLFPNDPQKRALINQRLYFDMGTLHDSFMKYYYPFIRTGQLGNAENYKKV--------EAAF 134
            ::|||:|.|.:|||:::|||::|...:..:.....:|..       .||..::        |..:
  Fly    81 RNDSLYPKDLKKRAIVDQRLHYDSSVVTSTGRAITFPLF-------WENKTEIPQARIDALEGVY 138

  Fly   135 EFLDIFLEGQDYVAGSQLTVADIAILSSVSTFEV-VEFDISKYPNVARWYANAKKITPGWDE 195
            :.|::|||..:|:||..||:||..:::.::.|.| :..|.:|||.:|.|....|:: |.::|
  Fly   139 KSLNLFLENGNYLAGDNLTIADFHVIAGLTGFFVFLPVDATKYPELAAWIKRIKEL-PYYEE 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 69/179 (39%)
GST_N_Delta_Epsilon 1..74 CDD:239343 30/60 (50%)
GST_C_Delta_Epsilon 88..204 CDD:198287 33/117 (28%)
GstE3NP_611325.2 GstA 4..195 CDD:223698 70/186 (38%)
GST_N_Delta_Epsilon 4..77 CDD:239343 30/60 (50%)
GST_C_Delta_Epsilon 91..208 CDD:198287 33/117 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460304
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.