DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and clic4

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_958894.1 Gene:clic4 / 368255 ZFINID:ZDB-GENE-030326-3 Length:252 Species:Danio rerio


Alignment Length:214 Identity:45/214 - (21%)
Similarity:79/214 - (36%) Gaps:62/214 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SRTIIMVAKALGLELNKKQLRITEGEHLKPEFLK-LNPQHTIPTLVDNGFAIWESRAIAVYLVEK 75
            |:.:.|:....|:..|...:.:..    ||..|: |.|....|.:..||....:...|..||   
Zfish    37 SQRLFMILWLKGVVFNVTTVDLKR----KPADLQNLAPGTHPPFITFNGEVKTDVNKIEEYL--- 94

  Fly    76 YGKDDSLFPNDPQKRALINQRLYFDMGTLH--------DSFMKYYYPFIRTG--------QLGNA 124
               :|.|.|  |:         |..:|..|        |.|.| :..||:..        :.|..
Zfish    95 ---EDILCP--PK---------YSKLGARHPESNTAGMDIFAK-FSAFIKNSKPDANEALERGLL 144

  Fly   125 ENYKKVEAAFEFL--------------DIFLEGQDYVAGSQLTVADIAILSSVSTFEVVE----- 170
            :..:|::   |:|              ::....:.::.|.::|:||..:|..:...:||.     
Zfish   145 KTLQKLD---EYLCSPLPDEIDHNSMEEVKASTRMFLDGEEMTLADCNLLPKLHIVKVVAKKYRG 206

  Fly   171 FDISK-YPNVARWYANAKK 188
            |:|.| ...:.|:..||.|
Zfish   207 FEIPKDLTGIWRYLNNAYK 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 42/208 (20%)
GST_N_Delta_Epsilon 1..74 CDD:239343 15/62 (24%)
GST_C_Delta_Epsilon 88..204 CDD:198287 26/137 (19%)
clic4NP_958894.1 GST_N_CLIC 13..103 CDD:239359 19/86 (22%)
O-ClC 16..250 CDD:129941 45/214 (21%)
GST_C_CLIC4 110..250 CDD:198329 24/120 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589434
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.