DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and GstT1

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster


Alignment Length:223 Identity:58/223 - (26%)
Similarity:108/223 - (48%) Gaps:16/223 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FYYSPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWESRA 67
            :||...|..||.:.:..|..........:.:.:.|.|..|:..:|....:|.:||..|.:.||.:
  Fly     7 YYYDFLSQPSRALWIAMKLGKTPFEDCPVALRKQEQLTDEYRSINRFQKVPAIVDGKFQLGESVS 71

  Fly    68 IAVYLVEKYGKDDSLFPNDPQKRALINQRL---YFDMGTLHDSFMK--YYYPFIRTGQLGNAENY 127
            |..||.:|....:.|:|...::||.:::.|   :|::..:...|.:  :..|..........|:.
  Fly    72 IVRYLADKGVFSEQLYPKTLEERARVDEFLEWQHFNVRLVCSLFFRQVWLLPAKGLAPAPKPESV 136

  Fly   128 KK----VEAAFEFLD-IFLEGQDYVAGSQLTVADIAILSSVSTFEVVEFDIS--KYPNVARWYAN 185
            ||    ||:....|: ::|| :|::.|.:||||||...|.::..::.:::::  ::|.||:|...
  Fly   137 KKLIKDVESNLGLLERLWLE-KDFLVGDKLTVADIFGSSEINQMKLCQYNVNEKQFPKVAKWMER 200

  Fly   186 AKKIT-PGWDENWKGLLQMKTMYEAQKA 212
            .:..| |.:||...  ...||..:|.||
  Fly   201 VRDATNPYYDEAHS--FVYKTSQQAVKA 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 49/192 (26%)
GST_N_Delta_Epsilon 1..74 CDD:239343 19/70 (27%)
GST_C_Delta_Epsilon 88..204 CDD:198287 31/128 (24%)
GstT1NP_610509.2 GstA 5..204 CDD:223698 49/197 (25%)
GST_N_Theta 5..80 CDD:239348 19/72 (26%)
GST_C_Theta 93..218 CDD:198292 31/127 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460067
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.650

Return to query results.
Submit another query.