DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and GstT3

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster


Alignment Length:217 Identity:57/217 - (26%)
Similarity:95/217 - (43%) Gaps:38/217 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FYYSPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLK-LNPQHTIPTLVDNGFAIWESR 66
            :||...|..||.:.::.:...:......:.:..||||..:|.| :|....:|.:.|||:.:.||.
  Fly    47 YYYDLMSQPSRALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYKLAESV 111

  Fly    67 AIAVYLVEKYGKDDSLFPNDPQKRALINQRLYFDMGTLHDSFMKYYY--------PFIRTGQL-- 121
            ||..||..|....:.|:|.            ||...:..|.|:::.:        .:.||..|  
  Fly   112 AILRYLSAKGKIPEHLYPK------------YFVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEP 164

  Fly   122 ---GNAENYKKVEAAFEF-----LD----IFLEGQDYVAGSQLTVADIAILSSVSTFEVVEFDIS 174
               |...:..|:| .|..     ||    ::|||:|::.||.||||||.....:....:.::|:.
  Fly   165 LLTGRTPSEAKIE-TFRMQMERNLDVVEEVWLEGKDFLTGSSLTVADIFAACEIEQTRMADYDVR 228

  Fly   175 -KYPNVARWYANAKK-ITPGWD 194
             |||.:..|....:: ..|.:|
  Fly   229 IKYPKIRAWLKRVRQSCNPYYD 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 55/204 (27%)
GST_N_Delta_Epsilon 1..74 CDD:239343 22/71 (31%)
GST_C_Delta_Epsilon 88..204 CDD:198287 32/131 (24%)
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 22/73 (30%)
GstA 47..243 CDD:223698 55/208 (26%)
GST_C_Theta 135..259 CDD:198292 30/117 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460047
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.650

Return to query results.
Submit another query.