DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and GstT4

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster


Alignment Length:207 Identity:47/207 - (22%)
Similarity:101/207 - (48%) Gaps:12/207 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFYYSPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFL-KLNPQHTIPTLVDNGFAIWE 64
            :.||:...:..||.:.::.:|..:......:.:.:||||..||. .:|....:|.:.|:|:.:.|
  Fly     5 LKFYFDFLNQSSRALYILLEASKIPFEAIPISMLKGEHLTGEFRDNVNRFRKLPAITDHGYQLSE 69

  Fly    65 SRAIAVYLVEKYGKDDSLFPNDPQKRALINQRLYF---DMGTLHDSF--MKYYYPFI-RTGQLGN 123
            :.||..:|..:....:..:|.....|:.|::.|.:   :||.....:  .|:..|:: :|....|
  Fly    70 NVAIFRHLAREKLVPEHWYPRRHLGRSRIDEYLAWQQTNMGVATTEYFQQKWLVPYLQKTRPADN 134

  Fly   124 AENY--KKVEAAF-EFLDIFLEGQDYVAGSQLTVADIAILSSVSTFEVVEFDISKYPN-VARWYA 184
            |.|.  |::|... ||..:||..:.::.|..::.||::.:..:...:.:.::..:..| :||||.
  Fly   135 AVNLASKQLEHTLNEFEQLFLNSRKFMMGDNISYADLSAICEIDQPKSIGYNAFQNRNKLARWYE 199

  Fly   185 NAK-KITPGWDE 195
            ..: ::.|.:.|
  Fly   200 TVREELGPHYKE 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 44/193 (23%)
GST_N_Delta_Epsilon 1..74 CDD:239343 19/73 (26%)
GST_C_Delta_Epsilon 88..204 CDD:198287 27/119 (23%)
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 19/74 (26%)
GST_C_Theta 95..220 CDD:198292 27/117 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459976
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
65.750

Return to query results.
Submit another query.