DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and Gdap1l1

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:XP_038961050.1 Gene:Gdap1l1 / 311616 RGDID:1304960 Length:369 Species:Rattus norvegicus


Alignment Length:262 Identity:53/262 - (20%)
Similarity:94/262 - (35%) Gaps:79/262 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YYSPRSSGSRTIIMVAKAL---GLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWES 65
            |:..:|..|:..:.|...:   ||...::.:.:.:.||.:|.|::||....:|.::.....|.:.
  Rat    50 YHWTQSFSSQKHLQVRLVIAEKGLSCEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDY 114

  Fly    66 RAIAVYLVEKYGKDD--SLFP--NDPQKRALINQR-----LYFDMGT----LH-----DSFM-KY 111
            ..|..|:...:..:.  :|.|  ..||...::..|     |..|..|    ||     ||.: ||
  Rat   115 DQIIDYVERTFTGEHVVALMPEAGSPQHARVLQYRELLDALPMDAYTHGCILHPELTTDSMIPKY 179

  Fly   112 YYPFIRTGQLGNA---------------ENY--------------------KK-----------V 130
            ....||. .|.||               |.|                    ||           :
  Rat   180 ATAEIRR-HLANATTDLMKLDHEEPQLSEPYLSKQKKLMAKILEHDDVGYLKKILGELAMVLDQI 243

  Fly   131 EAAFEFLDIFLEGQD---YVAGSQLTVADIAILSSVSTFEVVEFDISKY------PNVARWYANA 186
            ||..|...:..|||.   ::.|...|:||:.:.:::...:.:... .||      ||:..::...
  Rat   244 EAELEKRKLENEGQTCELWLCGCAFTLADVLLGATLHRLKFLGLS-KKYWEDGSRPNLQSFFERV 307

  Fly   187 KK 188
            ::
  Rat   308 QR 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 53/256 (21%)
GST_N_Delta_Epsilon 1..74 CDD:239343 16/72 (22%)
GST_C_Delta_Epsilon 88..204 CDD:198287 34/171 (20%)
Gdap1l1XP_038961050.1 Thioredoxin_like 47..122 CDD:412351 16/71 (23%)
GST_C_family 203..313 CDD:413470 18/108 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348207
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.