DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and Clic3

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001013098.2 Gene:Clic3 / 296566 RGDID:1307249 Length:237 Species:Rattus norvegicus


Alignment Length:140 Identity:28/140 - (20%)
Similarity:54/140 - (38%) Gaps:29/140 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PQHTIPTLVDNGFAIWESRAIAVYLVEKYGKDDSLFPNDPQKRALINQRLYFDMGTLHDSFMKYY 112
            |...:|.|:.:|....::..|..:|.|..|..|  ||....:        |.:..|..:.....:
  Rat    59 PGSQLPILLYDGDVKTDTLQIEEFLEETLGPPD--FPGLAPR--------YRESNTAGNDIFHKF 113

  Fly   113 YPFIRTGQLGNAEN--YKKVEAAFEFLDIFL----------------EGQDYVAGSQLTVADIAI 159
            ..||: ..:...::  |:::..|...||.:|                ..:.::.|.|||:||.::
  Rat   114 SAFIK-NPVPTQDDALYQQLLRALTRLDRYLGTPLDHELAQEPHLSESRRRFLDGDQLTLADCSL 177

  Fly   160 LSSVSTFEVV 169
            |..:...:.|
  Rat   178 LPKLHIVDTV 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 28/140 (20%)
GST_N_Delta_Epsilon 1..74 CDD:239343 6/25 (24%)
GST_C_Delta_Epsilon 88..204 CDD:198287 17/100 (17%)
Clic3NP_001013098.2 O-ClC 6..230 CDD:129941 28/140 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348163
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.