DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and GSTZ1

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001350632.1 Gene:GSTZ1 / 2954 HGNCID:4643 Length:217 Species:Homo sapiens


Alignment Length:186 Identity:51/186 - (27%)
Similarity:87/186 - (46%) Gaps:24/186 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RSSGSRTIIMVAKALGLELNKKQLRITE--GEHLKPEFLKLNPQHTIPTLVDNGFAIWESRAIAV 70
            |||.|..:.:.....|::.....:.:.:  |:....:|..|||...:|||..:|..|.:|.||..
Human    14 RSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVPTLKIDGITIHQSLAIIE 78

  Fly    71 YLVEKYGKDDSLFPNDPQKRALINQRLYFDM--GTLHD----SFMKYYYPFIRTG---QLGNAEN 126
            || |:......|.|.||:|||.:  |:..|:  |.:..    |.:|      :.|   ||..|:|
Human    79 YL-EEMRPTPRLLPQDPKKRASV--RMISDLIAGGIQPLQNLSVLK------QVGEEMQLTWAQN 134

  Fly   127 YKKVEAAFEFLDIFLEGQD--YVAGSQLTVADIAILSSVSTFEVVEFDISKYPNVA 180
              .:...|..|:..|:...  |..|.::|:||:.::..|:..|..:.|::.||.::
Human   135 --AITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTIS 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 51/186 (27%)
GST_N_Delta_Epsilon 1..74 CDD:239343 20/67 (30%)
GST_C_Delta_Epsilon 88..204 CDD:198287 26/104 (25%)
GSTZ1NP_001350632.1 maiA 8..212 CDD:273527 51/186 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.