Sequence 1: | NP_524913.1 | Gene: | GstD4 / 48337 | FlyBaseID: | FBgn0010040 | Length: | 215 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001009651.1 | Gene: | Clic2 / 294141 | RGDID: | 1306580 | Length: | 245 | Species: | Rattus norvegicus |
Alignment Length: | 198 | Identity: | 44/198 - (22%) |
---|---|---|---|
Similarity: | 81/198 - (40%) | Gaps: | 40/198 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 IIMVAKALGLELNKKQLRITEGEHLKPEFLK-LNPQHTIPTLVDNGFAIWESRAIAVYLVEKYGK 78
Fly 79 DDSLFPNDPQKRALINQRLYFDMGTLHDSFMKYYYPFIRTGQLGNAENYKK-VEAAFEFLDIF-- 140
Fly 141 ----------------LEGQDYVAGSQLTVADIAILSSVSTFEVV-----EFDI-SKYPNVARWY 183
Fly 184 ANA 186 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD4 | NP_524913.1 | PRK10542 | 1..184 | CDD:182533 | 42/194 (22%) |
GST_N_Delta_Epsilon | 1..74 | CDD:239343 | 13/59 (22%) | ||
GST_C_Delta_Epsilon | 88..204 | CDD:198287 | 28/124 (23%) | ||
Clic2 | NP_001009651.1 | Required for insertion into the membrane. /evidence=ECO:0000250 | 1..96 | 14/68 (21%) | |
GST_N_CLIC | 9..99 | CDD:239359 | 15/71 (21%) | ||
O-ClC | 12..245 | CDD:129941 | 44/198 (22%) | ||
GST_C_CLIC2 | 106..244 | CDD:198331 | 28/119 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166348048 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |