DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and Clic2

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001009651.1 Gene:Clic2 / 294141 RGDID:1306580 Length:245 Species:Rattus norvegicus


Alignment Length:198 Identity:44/198 - (22%)
Similarity:81/198 - (40%) Gaps:40/198 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IIMVAKALGLELNKKQLRITEGEHLKPEFLK-LNPQHTIPTLVDNGFAIWESRAIAVYLVEKYGK 78
            :.|:....|::.|...:....    |||.|| |.|....|.|:.|     :........:|::.:
  Rat    36 LFMILWLKGVKFNVTTIDTAR----KPEELKDLAPGTNPPFLIYN-----KELKTDFIKIEEFLE 91

  Fly    79 DDSLFPNDPQKRALINQRLYFDMGTLHDSFMKYYYPFIRTGQLGNAENYKK-VEAAFEFLDIF-- 140
            .....|..|.......:.  ||:|.  :.|.| :..:|:..|....:|::| :...|:.||.:  
  Rat    92 KTLAPPRYPHLSPKYKES--FDVGC--NLFAK-FSAYIKNTQKEANKNFEKSLLREFKRLDDYLN 151

  Fly   141 ----------------LEGQDYVAGSQLTVADIAILSSVSTFEVV-----EFDI-SKYPNVARWY 183
                            |..:.::.|.|||:||.::|..::..:|.     :||| :::..|.|:.
  Rat   152 TPLLDEIDPDSTEERTLSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYL 216

  Fly   184 ANA 186
            .||
  Rat   217 HNA 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 42/194 (22%)
GST_N_Delta_Epsilon 1..74 CDD:239343 13/59 (22%)
GST_C_Delta_Epsilon 88..204 CDD:198287 28/124 (23%)
Clic2NP_001009651.1 Required for insertion into the membrane. /evidence=ECO:0000250 1..96 14/68 (21%)
GST_N_CLIC 9..99 CDD:239359 15/71 (21%)
O-ClC 12..245 CDD:129941 44/198 (22%)
GST_C_CLIC2 106..244 CDD:198331 28/119 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348048
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.