DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and GSTA1

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:XP_005249091.1 Gene:GSTA1 / 2938 HGNCID:4626 Length:225 Species:Homo sapiens


Alignment Length:215 Identity:50/215 - (23%)
Similarity:95/215 - (44%) Gaps:57/215 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YYSPRSSGSRTIIMVAKALGLELNKKQLRITEG-EHLKPEFLKLNPQHTIPTLVDNGFAIWESRA 67
            |::.|.....|..::| |.|:|..:|.::..|. :.|:.:...:..|  :|.:..:|..:.::||
Human     9 YFNARGRMESTRWLLA-AAGVEFEEKFIKSAEDLDKLRNDGYLMFQQ--VPMVEIDGMKLVQTRA 70

  Fly    68 IAVYLVEKYGKDDSLFPNDPQKRALINQRLYF----DMG-------------------TLHDSFM 109
            |..|:..||    :|:..|.::||||:  :|.    |:|                   .:.:...
Human    71 ILNYIASKY----NLYGKDIKERALID--MYIEGIADLGEMILLLPVCPPEEKDAKLALIKEKIK 129

  Fly   110 KYYYPFIRTGQLGNAENYKKVEAAFEFLDIFLEGQDYVAGSQLTVADIAILSSVSTFEVVEFD-- 172
            ..|:|                  |||.: :...||||:.|::|:.|||.::..:  :.|.|.|  
Human   130 NRYFP------------------AFEKV-LKSHGQDYLVGNKLSRADIHLVELL--YYVEELDSS 173

  Fly   173 -ISKYPNVARWYANAKKITP 191
             ||.:|.:...:..|::.:|
Human   174 LISSFPLLKVTHFTAQRGSP 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 48/206 (23%)
GST_N_Delta_Epsilon 1..74 CDD:239343 17/70 (24%)
GST_C_Delta_Epsilon 88..204 CDD:198287 29/130 (22%)
GSTA1XP_005249091.1 GST_N_Alpha 4..82 CDD:239375 19/79 (24%)
GST_C_family 86..>182 CDD:295467 27/118 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.