DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and gst-34

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_741060.2 Gene:gst-34 / 260015 WormBaseID:WBGene00001782 Length:218 Species:Caenorhabditis elegans


Alignment Length:163 Identity:33/163 - (20%)
Similarity:63/163 - (38%) Gaps:43/163 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 FLKL---NPQHTIPTLVDNGFAIWESRAIAVYLVEKYG-----KDDSLFPNDPQKRALINQRLYF 99
            ||.|   .|....|.|..:||.:.:|.||..||..|:|     .:|..|.:     ::::|    
 Worm    48 FLALKDKTPFGRFPVLSIDGFDLAQSTAIHRYLARKFGYAGKSPEDEAFAD-----SIVDQ---- 103

  Fly   100 DMGTLHDSFMKYYYPFIRTGQLGN-AENYKKV---------EAAFEFLDIFLE--GQDYVAGSQL 152
                 ...:::.:.|.:...:.|. .|..|::         ...|:.|...|:  ..:|:.|..|
 Worm   104 -----VKEYLESFRPLLYAQKSGKPEEEVKRIHDEVYIPVKNLLFKILTRILKESKSEYLVGDGL 163

  Fly   153 TVADIAI---------LSSVSTFEVVEFDISKY 176
            |.||:.:         :..:...:.:..::.||
 Worm   164 TWADLVVADHLYSLTNIKELDPEDPIHLNLKKY 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 33/163 (20%)
GST_N_Delta_Epsilon 1..74 CDD:239343 13/33 (39%)
GST_C_Delta_Epsilon 88..204 CDD:198287 16/110 (15%)
gst-34NP_741060.2 GST_N_Sigma_like 4..82 CDD:239337 13/33 (39%)
PTZ00057 6..213 CDD:173353 33/163 (20%)
GST_C_Sigma_like 92..200 CDD:198301 18/119 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.