DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and CLIC4

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_039234.1 Gene:CLIC4 / 25932 HGNCID:13518 Length:253 Species:Homo sapiens


Alignment Length:157 Identity:35/157 - (22%)
Similarity:63/157 - (40%) Gaps:45/157 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PEFLKLNPQHTIPTLVDNGFAIWESRAIAVYLVEK---YGKDDSLFPNDPQKRALIN--QRLYFD 100
            |::|||:|:|.            ||....:.:..|   |.|:.....|:..:|.|:.  |:|   
Human   102 PKYLKLSPKHP------------ESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKL--- 151

  Fly   101 MGTLHDSFMKYYYPFIRTGQLGNAENYKKVEAAFEFLDIFLEGQDYVAGSQLTVADIAILSSVST 165
                 |.::        ...|.:..:...:|      ||....:.::.|:::|:||..:|..:..
Human   152 -----DEYL--------NSPLPDEIDENSME------DIKFSTRKFLDGNEMTLADCNLLPKLHI 197

  Fly   166 FEVV-----EFDISK-YPNVARWYANA 186
            .:||     .|||.| ...:.|:..||
Human   198 VKVVAKKYRNFDIPKEMTGIWRYLTNA 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 33/153 (22%)
GST_N_Delta_Epsilon 1..74 CDD:239343 8/32 (25%)
GST_C_Delta_Epsilon 88..204 CDD:198287 23/107 (21%)
CLIC4NP_039234.1 Required for insertion into the membrane. /evidence=ECO:0000305 2..101
O-ClC 17..252 CDD:129941 35/157 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154229
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.