DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and GSTT4

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001345593.1 Gene:GSTT4 / 25774 HGNCID:26930 Length:241 Species:Homo sapiens


Alignment Length:211 Identity:54/211 - (25%)
Similarity:99/211 - (46%) Gaps:31/211 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFYYSPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWES 65
            ::.|....|:..|.:.:.:|...::.|.:.:.:.:|.|....::.:||...:|:|.|..|.:.||
Human     3 LELYMDLLSAPCRAVYIFSKKHDIQFNFQFVDLLKGHHHSKGYIDINPLRKLPSLKDGKFILSES 67

  Fly    66 RAIAVYLVEKYGKDDSLFPNDPQKRALIN-----QRLYFDMGTLHDSFMKYYYPFIRTGQLGNAE 125
            .||..||..||.......|.||..||.::     |...|.:......::|...|.| ||:..:||
Human    68 AAILYYLCRKYSAPSHWCPPDPHARARVDEFVAWQHTAFQLPMKKIVWLKLLIPKI-TGEEVSAE 131

  Fly   126 NYKKVEAAFE--------FLDIFLEGQDYVAGSQLTVADIAILSSVSTFEVVEFDISKYPNVARW 182
               |:|.|.|        |.:.||:.:.::.|:|:::||:     |:..|:::...:.| ||   
Human   132 ---KMEHAVEEVKNSLQLFEEYFLQDKMFITGNQISLADL-----VAVVEMMQPMAANY-NV--- 184

  Fly   183 YANAKKITPGWDENWK 198
            :.|:.|:.     .|:
Human   185 FLNSSKLA-----EWR 195

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 51/195 (26%)
GST_N_Delta_Epsilon 1..74 CDD:239343 19/72 (26%)
GST_C_Delta_Epsilon 88..204 CDD:198287 30/124 (24%)
GSTT4NP_001345593.1 Thioredoxin_like 3..78 CDD:320948 19/74 (26%)