DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and GstE9

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster


Alignment Length:176 Identity:64/176 - (36%)
Similarity:96/176 - (54%) Gaps:9/176 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWESRAIAVYLVEKYG 77
            |...:...||||:...:.:.:..|||...||...|||||:|.|.|:|..||||.||..|||.:|.
  Fly    16 RACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLEDDGKFIWESHAICAYLVRRYA 80

  Fly    78 KDDSLFPNDPQKRALINQRLYFDMGTLHDSFMK-----YYYPFIRTGQLGNAENYKKVEAAFEFL 137
            |.|.|:|.|..||||::|||:|:.|.|....::     .:|..|........:   .:..|::||
  Fly    81 KSDDLYPKDYFKRALVDQRLHFESGVLFQGCIRNIAIPLFYKNITEVPRSQID---AIYEAYDFL 142

  Fly   138 DIFLEGQDYVAGSQLTVADIAILSSVSTF-EVVEFDISKYPNVARW 182
            :.|:..|.|:.|..:|:||.:::||||:. .:...|..:||.:..|
  Fly   143 EAFIGNQAYLCGPVITIADYSVVSSVSSLVGLAAIDAKRYPKLNGW 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 64/176 (36%)
GST_N_Delta_Epsilon 1..74 CDD:239343 27/60 (45%)
GST_C_Delta_Epsilon 88..204 CDD:198287 30/101 (30%)
GstE9NP_725784.1 GstA 4..201 CDD:223698 64/176 (36%)
GST_N_Delta_Epsilon 4..76 CDD:239343 26/59 (44%)
GST_C_Delta_Epsilon 92..209 CDD:198287 30/100 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460305
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.