DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and AIMP3

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_660194.1 Gene:AIMP3 / 246507 FlyBaseID:FBgn0050185 Length:179 Species:Drosophila melanogaster


Alignment Length:93 Identity:22/93 - (23%)
Similarity:45/93 - (48%) Gaps:15/93 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 GNAENYKKVEAAFEFLDIFLEGQDYVAGSQLTVADIAILSSVSTFEVVE----FDISKYPNVARW 182
            |:.:.|...:...:|..:| ..:.|:.|..:|:||:|:..::  :::|:    .|...|.|::||
  Fly    85 GSKDKYVSKQLLADFNKLF-ASKSYLVGHFITLADLAVYYAI--YDLVKSLSPVDKEVYLNLSRW 146

  Fly   183 Y---ANAKKITPGWDENWKGLLQMKTMY 207
            :   .|...:..|     :.||...|:|
  Fly   147 FDHLQNRADVHQG-----EPLLNFTTIY 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 16/68 (24%)
GST_N_Delta_Epsilon 1..74 CDD:239343
GST_C_Delta_Epsilon 88..204 CDD:198287 20/88 (23%)
AIMP3NP_660194.1 GST_C_AIMP3 65..166 CDD:198338 20/88 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.