DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and Gstp3

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:XP_030106733.1 Gene:Gstp3 / 225884 MGIID:2385078 Length:260 Species:Mus musculus


Alignment Length:178 Identity:39/178 - (21%)
Similarity:73/178 - (41%) Gaps:30/178 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KQLRITEGEHLKPEFLKLN--PQHT---------IPTLVDNGFAIWESRAIAVYLVEKYGKDDSL 82
            :.|...:|:..|.|.:.|:  .|.|         ||...|....:::|..|..:|...:|    |
Mouse    69 RMLLADQGQSWKEEVVTLDVWEQGTFKASCLFGQIPKFQDGELTLYQSNTILRHLGRSFG----L 129

  Fly    83 FPNDPQKRALINQRLYFDM--GTLHDSFMKYYYPFIRTGQLGNAENYKKVEAAFEFLDIFLE--- 142
            :..|.|:.||:      ||  ..|.|.|.:....:....:.|..:..|::....:..:..|.   
Mouse   130 YGKDQQEAALV------DMVNDGLEDLFRRIARQYRHILKEGKDQYQKELPGHLKPFETLLAQNR 188

  Fly   143 -GQDYVAGSQLTVADIAILSSVSTFEVVEFD--ISKYPNVARWYANAK 187
             ||.::.|.|::.||..:|..:...|:: |.  ::.:|..:.:.|..|
Mouse   189 GGQSFIVGDQISFADYRLLDVLLNLELL-FPGYLNDFPLFSAYVARLK 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 37/173 (21%)
GST_N_Delta_Epsilon 1..74 CDD:239343 13/55 (24%)
GST_C_Delta_Epsilon 88..204 CDD:198287 23/108 (21%)
Gstp3XP_030106733.1 Thioredoxin_like 63..126 CDD:381987 13/56 (23%)
GST_C_family 134..253 CDD:383119 23/109 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.