Sequence 1: | NP_524913.1 | Gene: | GstD4 / 48337 | FlyBaseID: | FBgn0010040 | Length: | 215 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006524198.1 | Gene: | Clic5 / 224796 | MGIID: | 1917912 | Length: | 485 | Species: | Mus musculus |
Alignment Length: | 202 | Identity: | 45/202 - (22%) |
---|---|---|---|
Similarity: | 73/202 - (36%) | Gaps: | 41/202 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 SRTIIMVAKALGLELNKKQLRITEGEHLKPEFL-KLNPQHTIPTLVDNGFAIWESRAIAVYLVEK 75
Fly 76 YGKDDSLFPNDPQKRALINQRLYFDMGTLH-DSFMKYYYPFIRTGQLGNAENYKKVEAAFEFLDI 139
Fly 140 FLEG------------------QDYVAGSQLTVADIAILSSVSTFEVVEFDISKYPNVARWYANA 186
Fly 187 KKITPGW 193 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD4 | NP_524913.1 | PRK10542 | 1..184 | CDD:182533 | 42/191 (22%) |
GST_N_Delta_Epsilon | 1..74 | CDD:239343 | 15/62 (24%) | ||
GST_C_Delta_Epsilon | 88..204 | CDD:198287 | 28/125 (22%) | ||
Clic5 | XP_006524198.1 | O-ClC | 248..483 | CDD:129941 | 45/202 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167844775 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |