DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and Clic5

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:XP_006524198.1 Gene:Clic5 / 224796 MGIID:1917912 Length:485 Species:Mus musculus


Alignment Length:202 Identity:45/202 - (22%)
Similarity:73/202 - (36%) Gaps:41/202 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SRTIIMVAKALGLELNKKQLRITEGEHLKPEFL-KLNPQHTIPTLVDNGFAIWESRAIAVYLVEK 75
            |:.:.|:....|:..|...:.:..    ||..| .|.|....|.|..||....:...|..:|   
Mouse   269 SQRLFMILWLKGVVFNVTTVDLKR----KPADLHNLAPGTHPPFLTFNGDVKTDVNKIEEFL--- 326

  Fly    76 YGKDDSLFPNDPQKRALINQRLYFDMGTLH-DSFMKYYYPFIRTGQLGNAENYKKVEAAFEFLDI 139
               :::|.|....|.|..::    :..|.. |.|.|:......|.|..||...:.:..|...||.
Mouse   327 ---EETLTPEKYPKLAAKHR----ESNTAGIDIFSKFSAYIKNTKQQNNAALERGLTKALRKLDD 384

  Fly   140 FLEG------------------QDYVAGSQLTVADIAILSSVSTFEVVEFDISKYPNVARWYANA 186
            :|..                  :.::.|.:||:||..:|..:   .||:....||.|    |...
Mouse   385 YLNSPLPEEIDTNTHGDEKGSQRKFLDGDELTLADCNLLPKL---HVVKIVAKKYRN----YDIP 442

  Fly   187 KKITPGW 193
            .::|..|
Mouse   443 AEMTGLW 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 42/191 (22%)
GST_N_Delta_Epsilon 1..74 CDD:239343 15/62 (24%)
GST_C_Delta_Epsilon 88..204 CDD:198287 28/125 (22%)
Clic5XP_006524198.1 O-ClC 248..483 CDD:129941 45/202 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844775
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.