Sequence 1: | NP_524913.1 | Gene: | GstD4 / 48337 | FlyBaseID: | FBgn0010040 | Length: | 215 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_497662.1 | Gene: | Y53G8B.1 / 190243 | WormBaseID: | WBGene00021817 | Length: | 213 | Species: | Caenorhabditis elegans |
Alignment Length: | 203 | Identity: | 53/203 - (26%) |
---|---|---|---|
Similarity: | 84/203 - (41%) | Gaps: | 48/203 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 YSPRSSGSRTIIMVA---KALGLE------LNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGF 60
Fly 61 AIWESRAIAVYLVEKYGKDDSLFPNDPQKRA---------------LINQRLYFDMGTLHDSFMK 110
Fly 111 YY-YPFIRTGQLGNAENYKKVEAAFEFLDIFLEGQDYVAGSQLTVADIAILSSV-STFEVVEFDI 173
Fly 174 SKYPNVAR 181 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD4 | NP_524913.1 | PRK10542 | 1..184 | CDD:182533 | 53/203 (26%) |
GST_N_Delta_Epsilon | 1..74 | CDD:239343 | 25/77 (32%) | ||
GST_C_Delta_Epsilon | 88..204 | CDD:198287 | 22/111 (20%) | ||
Y53G8B.1 | NP_497662.1 | Thioredoxin_like | 5..76 | CDD:294274 | 24/76 (32%) |
maiA | 18..211 | CDD:273527 | 48/193 (25%) | ||
GST_C_Zeta | 89..207 | CDD:198300 | 23/112 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C160163417 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.740 |