DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and Y53G8B.1

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_497662.1 Gene:Y53G8B.1 / 190243 WormBaseID:WBGene00021817 Length:213 Species:Caenorhabditis elegans


Alignment Length:203 Identity:53/203 - (26%)
Similarity:84/203 - (41%) Gaps:48/203 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YSPRSSGSRTIIMVA---KALGLE------LNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGF 60
            ||..|||..:.:..|   |.:..|      |||::         :.||...||...:|.|..||.
 Worm     8 YSSWSSGCSSRVRTALALKKIDYEYQPVNLLNKQK---------EQEFHGNNPAEKVPILKINGL 63

  Fly    61 AIWESRAIAVYLVEKYGKDDSLFPNDPQKRA---------------LINQRLYFDMGTLHDSFMK 110
            .:.||.||..||.|.| .|..|.|.:|:.:|               |.|:.:|..:......:..
 Worm    64 TLTESMAIIEYLDEIY-PDPPLLPKEPELKARARAIAFHIASNIQPLQNKPIYLMLNEKEPGYGD 127

  Fly   111 YY-YPFIRTGQLGNAENYKKVEAAFEFLDIFLEGQDYVAGSQLTVADIAILSSV-STFEVVEFDI 173
            :: ..||..|       :|.:|...:     :...|:..|:|:::|||.:.|.| :..|....|:
 Worm   128 FWCQHFISKG-------FKALEELLQ-----MHSGDFCVGNQISIADICLPSIVYNAIEKYHVDM 180

  Fly   174 SKYPNVAR 181
            :.||.:.|
 Worm   181 TPYPIITR 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 53/203 (26%)
GST_N_Delta_Epsilon 1..74 CDD:239343 25/77 (32%)
GST_C_Delta_Epsilon 88..204 CDD:198287 22/111 (20%)
Y53G8B.1NP_497662.1 Thioredoxin_like 5..76 CDD:294274 24/76 (32%)
maiA 18..211 CDD:273527 48/193 (25%)
GST_C_Zeta 89..207 CDD:198300 23/112 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163417
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.