DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and gst-15

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_496860.1 Gene:gst-15 / 185410 WormBaseID:WBGene00001763 Length:213 Species:Caenorhabditis elegans


Alignment Length:183 Identity:41/183 - (22%)
Similarity:73/183 - (39%) Gaps:37/183 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 TEG--EHLKPEFLKLNPQHTIPTLVDNGFAIWESRAIAVYLVEKYGKDDSLFPNDPQKRALINQR 96
            |||  |.::.:    .|...:|.|..:||.|.:|.||..||.:|:|........:....|:::|.
 Worm    39 TEGKWEKMRDK----TPFGQLPVLNVDGFDIPQSAAICRYLAKKFGYAGKTPEEEAWADAVVDQF 99

  Fly    97 LYFDM-----------GTLHDSFMKYYYPFIRTGQLGNAENYKKVEAAFEFLDIFLE--GQDYVA 148
            ..|.:           |...:..:|..|......:          :..|..|:..|:  ...|:.
 Worm   100 KDFSVAFKTLLFATRAGKPEEEILKIRYEIFNPAR----------DVYFILLNRILKKSKSGYLV 154

  Fly   149 GSQLTVADIAI---LSSVSTFEVVEFDISKYPNVARWYANAKKI--TPGWDEN 196
            |..||.||:.|   |.|:.....::.|...:.|:.::   .:||  ||..:::
 Worm   155 GDGLTWADLVIADNLHSLEKLRAIDDDDEGHQNLKKY---KEKIYGTPDLEDH 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 37/167 (22%)
GST_N_Delta_Epsilon 1..74 CDD:239343 15/41 (37%)
GST_C_Delta_Epsilon 88..204 CDD:198287 24/127 (19%)
gst-15NP_496860.1 GST_N_Sigma_like 4..77 CDD:239337 15/41 (37%)
PTZ00057 6..211 CDD:173353 41/183 (22%)
GST_C_Sigma_like 87..195 CDD:198301 20/120 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.