DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and gst-24

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_496859.1 Gene:gst-24 / 185407 WormBaseID:WBGene00001772 Length:209 Species:Caenorhabditis elegans


Alignment Length:186 Identity:43/186 - (23%)
Similarity:79/186 - (42%) Gaps:39/186 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FYYSPR--SSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQ---HTIPTLVDNGFAI 62
            :|::.|  :..:|.:..:|     .:..:.:||..|   .||:..|.|:   ..:|.|..:||.|
 Worm     7 YYFNLRGWAEPARQLFKLA-----HVEFEDVRIENG---TPEWGALKPKTPFGQLPFLSVDGFEI 63

  Fly    63 WESRAIAVYLVEKYGKDDSLFPNDPQKRALINQRLYFDMGTLHDSFMKYYYP---FIRTGQLGNA 124
            .:|.||..||.:|:|........:....|::            |.|..:..|   .|...:.|||
 Worm    64 PQSAAILRYLAKKFGYAGKTSEEEAWVDAIV------------DQFKDFVTPLRQLIMAQRSGNA 116

  Fly   125 ENYKKV---------EAAFEFLDIFLE--GQDYVAGSQLTVADIAILSSVSTFEVV 169
            |..:::         :..|:.|:..||  ...::.|..:|.||:.|...::|.|::
 Worm   117 EEIERIQKEVFAPARDTFFKILNGILEKSKSGFLVGDGVTWADLVIADILTTMEML 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 43/186 (23%)
GST_N_Delta_Epsilon 1..74 CDD:239343 21/75 (28%)
GST_C_Delta_Epsilon 88..204 CDD:198287 20/96 (21%)
gst-24NP_496859.1 GST_N_Sigma_like 4..75 CDD:239337 21/75 (28%)
PTZ00057 6..208 CDD:173353 43/186 (23%)
GST_C_Sigma_like 85..191 CDD:198301 20/100 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.