DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and gst-38

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_506983.1 Gene:gst-38 / 185299 WormBaseID:WBGene00001786 Length:209 Species:Caenorhabditis elegans


Alignment Length:228 Identity:48/228 - (21%)
Similarity:90/228 - (39%) Gaps:46/228 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YYSPRSSGS--RTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWESR 66
            |:..|.:|.  |.|...|     |...:..|:|:.|..|.:.....|.:.:|.|..:|..:.:|.
 Worm     8 YFDGRGAGELCRQIFAAA-----EQKYEDNRLTDEEWEKFKAAGKTPYNQLPMLEVDGKPLAQSH 67

  Fly    67 AIAVYLVEKYGKDDSLFPNDPQKRALINQRLYFDMGTLHDSFMKYY---YPFIRTGQLGNAENYK 128
            |:|.||..::|.:.    ....:.|.:|        :|.|.:..||   .|::.. :||..|...
 Worm    68 AMARYLAREFGFNG----KSRWEEAQVN--------SLADQYKDYYAEARPYLAV-KLGYTEGDA 119

  Fly   129 KVEAAFEFLDIF------------LEGQDYVAGSQLTVADIAILS-SVSTFEVVEFDISKYPNVA 180
            :......:|.:|            ..|..::.|:.||..|:.:.. |.......:.|:  :.:|.
 Worm   120 EALYTSVYLPVFKKHYGFFVNALKASGSGFLVGNSLTFIDLLVAQHSADLLGREKSDL--FNDVP 182

  Fly   181 RWYANAKKITPGWDENWKGLLQMKTMYEAQKAS 213
            ...|:::|:        :.:.|:|...|.:.||
 Worm   183 EMKAHSEKV--------QSIPQIKKWIETRPAS 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 41/197 (21%)
GST_N_Delta_Epsilon 1..74 CDD:239343 20/71 (28%)
GST_C_Delta_Epsilon 88..204 CDD:198287 23/131 (18%)
gst-38NP_506983.1 GST_N_Sigma_like 4..75 CDD:239337 20/71 (28%)
PTZ00057 6..207 CDD:173353 46/226 (20%)
GST_C_Sigma_like 85..191 CDD:198301 21/116 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.