DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and gst-44

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_507142.2 Gene:gst-44 / 184405 WormBaseID:WBGene00001792 Length:254 Species:Caenorhabditis elegans


Alignment Length:168 Identity:40/168 - (23%)
Similarity:70/168 - (41%) Gaps:25/168 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KPE-FLKLNPQHTIPTL--VDNGFAIWESRAIAVYLVEKYGKDDSLFPNDPQKRALINQRLYFD- 100
            ||: :...|.:..:|||  .:....:.||..|..||.:.: .:..:.|:||.::  :.|:|..: 
 Worm    62 KPDWYFTKNYKGQVPTLEHAEGKKLVIESAVIPEYLDDIF-PETKILPSDPYEK--VQQKLLLER 123

  Fly   101 -MGTLHDSFMKYYYPFIRTGQLGNAENYKKVEAAFEFLDIFLEGQDYVAGSQLTVADIAILSSVS 164
             ...|..:|.:.:.......:|  .|.::.:..|||..:..|||..|...|.....|..|..|..
 Worm   124 LSDQLTPAFGRVFRAIKNPEEL--KEKFESILKAFEEAESLLEGAFYSGTSSPGFVDYLIYPSFQ 186

  Fly   165 -----TFEVVEFDISK-------YPNVARWYANAKKIT 190
                 ||.:..|.:..       ||.:::|:   |.||
 Worm   187 RVYWLTFLLEIFPLPSDNFPGPGYPKLSQWF---KAIT 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 37/160 (23%)
GST_N_Delta_Epsilon 1..74 CDD:239343 11/36 (31%)
GST_C_Delta_Epsilon 88..204 CDD:198287 26/117 (22%)
gst-44NP_507142.2 Thioredoxin_like 8..98 CDD:294274 10/35 (29%)
GstA 29..229 CDD:223698 40/168 (24%)
GST_C_family 112..245 CDD:295467 26/117 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.