DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and gst-42

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_509962.1 Gene:gst-42 / 183911 WormBaseID:WBGene00001790 Length:214 Species:Caenorhabditis elegans


Alignment Length:163 Identity:50/163 - (30%)
Similarity:72/163 - (44%) Gaps:33/163 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 EHLKPEFLKLNPQHTIPTLVDNGFAIWESRAIAVYLVEKYGKDDSLFPNDPQKRA---LINQRLY 98
            |..|.:..::||...:||.|.:|..|.||.||..||.|.: .|..|.|.||.|||   .|:..:.
 Worm    41 EEAKSKLKEINPAAKVPTFVVDGQVITESLAIIEYLEETH-PDVPLLPKDPIKRAHARAISLLVA 104

  Fly    99 FDMGTLHDSFMKYYYPFIRTGQLGNAENYKKVEAAF------EF-------LDIFLEGQD--YVA 148
            ..:..||:         ::..||.|     |.||.|      :|       |:|.|:...  |..
 Worm   105 SGIQPLHN---------LKVLQLLN-----KKEAGFGGQFAKQFVVEGLTALEILLKQHSGKYAV 155

  Fly   149 GSQLTVADIAILSSVSTFEVVEFDISKYPNVAR 181
            |..:|:||::|...:.:......|:|.||.|.|
 Worm   156 GDDVTIADLSIPPLIYSANRFNLDLSPYPTVNR 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 50/163 (31%)
GST_N_Delta_Epsilon 1..74 CDD:239343 15/36 (42%)
GST_C_Delta_Epsilon 88..204 CDD:198287 29/112 (26%)
gst-42NP_509962.1 GST_N_Zeta 6..77 CDD:239340 14/35 (40%)
maiA 7..211 CDD:273527 50/163 (31%)
GST_C_Zeta 90..207 CDD:198300 30/113 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.