DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and Gstz1

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_034493.1 Gene:Gstz1 / 14874 MGIID:1341859 Length:216 Species:Mus musculus


Alignment Length:195 Identity:52/195 - (26%)
Similarity:83/195 - (42%) Gaps:36/195 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YYSPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWESRAI 68
            |:....|....|.:..|.:..|:....|....|:....||..|||...:|.|..:|..|.:|.||
Mouse    11 YFRSSCSWRVRIALALKGIDYEIVPINLIKDGGQQFTEEFQTLNPMKQVPALKIDGITIVQSLAI 75

  Fly    69 AVYLVEKYGKDDSLFPNDPQKRALINQRLYFDMGTLHDSFMKYYYPFIRTG-----------QLG 122
            ..|| |:......|.|.||||||::  |:..|:              |.:|           |:|
Mouse    76 MEYL-EETRPIPRLLPQDPQKRAIV--RMISDL--------------IASGIQPLQNLSVLKQVG 123

  Fly   123 NAEN-----YKKVEAAFEFLDIFLEGQ--DYVAGSQLTVADIAILSSVSTFEVVEFDISKYPNVA 180
            . ||     .|.:.:.|..|:..|:..  .|..|.::::||:.::..|:..|..:.|:|.||.::
Mouse   124 Q-ENQMQWAQKVITSGFNALEKILQSTAGKYCVGDEVSMADVCLVPQVANAERFKVDLSPYPTIS 187

  Fly   181  180
            Mouse   188  187

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 52/195 (27%)
GST_N_Delta_Epsilon 1..74 CDD:239343 21/69 (30%)
GST_C_Delta_Epsilon 88..204 CDD:198287 26/111 (23%)
Gstz1NP_034493.1 GST_N_Zeta 6..80 CDD:239340 21/69 (30%)
maiA 7..211 CDD:273527 52/195 (27%)
Glutathione binding 14..19 1/4 (25%)