DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and Gstt2

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:XP_011241675.1 Gene:Gstt2 / 14872 MGIID:106188 Length:251 Species:Mus musculus


Alignment Length:229 Identity:52/229 - (22%)
Similarity:97/229 - (42%) Gaps:25/229 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFYYSPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWE- 64
            ::.|....|..||.:.:.||..|:....:.:.|.:|:|:..:|.::|..:.:|.|.|..|.:.| 
Mouse     3 LELYLDLLSQPSRAVYIFAKKNGIPFQTRTVDILKGQHMSEQFSQVNCLNKVPVLKDGSFVLTES 67

  Fly    65 ------SRAIAVYLVEKYGKDDSLFPNDPQKRALINQRLYFDMGTLHDSFMKYYYPFIRTGQLGN 123
                  |.||.:||..||...|..:|.|.|.||.:::.|.:....:..:|....:..:....:|.
Mouse    68 PSSMIPSTAILIYLSSKYQVADHWYPADLQARAQVHEYLGWHADNIRGTFGVLLWTKVLGPLIGV 132

  Fly   124 AENYKKVE--------AAFEFLDIFLEGQDYVAGSQLTVADIAILSSVSTFEVVEFDISKYPNVA 180
            ....:|||        ...:..|.||..:.::.|.|:|:||:..|..:.....:.:::       
Mouse   133 QVPQEKVERNRDRMVLVLQQLEDKFLRDRAFLVGQQVTLADLMSLEELMQPVALGYNL------- 190

  Fly   181 RWYANAKKITPGWDENWKGLLQMKTMYEAQKASL 214
              :....::| .|.|..:..|..:...||....|
Mouse   191 --FEGRPQLT-AWRERVEAFLGAELCQEAHSTIL 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 45/197 (23%)
GST_N_Delta_Epsilon 1..74 CDD:239343 22/79 (28%)
GST_C_Delta_Epsilon 88..204 CDD:198287 22/123 (18%)
Gstt2XP_011241675.1 GST_N_Theta 3..85 CDD:239348 22/81 (27%)
GST_C_Theta 98..223 CDD:198292 24/134 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844529
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.650

Return to query results.
Submit another query.