DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and Gstt1

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_032211.3 Gene:Gstt1 / 14871 MGIID:107379 Length:240 Species:Mus musculus


Alignment Length:204 Identity:53/204 - (25%)
Similarity:90/204 - (44%) Gaps:32/204 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFYYSPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWES 65
            ::.|....|...|.|.:.||...:......:.:.:||||...|.::||...:|.::|.||.:.||
Mouse     3 LELYLDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFARVNPMKRVPAMMDGGFTLCES 67

  Fly    66 RAIAVYLVEKYGKDDSLFPNDPQKRALINQRLYFDMGTLHDSFM-----KYYYPFIRTGQLGNAE 125
            .||.:||..||...|..:|.|.|.||.:::.|.:....|..|.:     |..:|..    ||...
Mouse    68 VAILLYLAHKYKVPDHWYPQDLQARARVDEYLAWQHTGLRRSCLRALWHKVMFPVF----LGEQI 128

  Fly   126 NYKKVEAAFEFLDI--------FLEGQDYVAGSQLTVADIAILSSV--------STFEVVEFDIS 174
            ..:.:.|....||:        ||:.:|::.|..:::||:..::.:        ..||       
Mouse   129 PPETLAATLAELDVNLQVLEDKFLQDKDFLVGPHISLADLVAITELMHPVGGGCPVFE------- 186

  Fly   175 KYPNVARWY 183
            .:|.:|.||
Mouse   187 GHPRLAAWY 195

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 53/204 (26%)
GST_N_Delta_Epsilon 1..74 CDD:239343 23/72 (32%)
GST_C_Delta_Epsilon 88..204 CDD:198287 25/117 (21%)
Gstt1NP_032211.3 GstA 3..212 CDD:223698 53/204 (26%)
GST_N_Theta 3..78 CDD:239348 23/74 (31%)