DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and AgaP_AGAP000883

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:XP_316859.4 Gene:AgaP_AGAP000883 / 1277399 VectorBaseID:AGAP000883 Length:427 Species:Anopheles gambiae


Alignment Length:192 Identity:45/192 - (23%)
Similarity:79/192 - (41%) Gaps:22/192 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YYSPRSSGSRTIIMVAKALGLELNKKQLRITEGE-HLKPEFLKLNPQHTIPTL-VDNGFAIWESR 66
            |..|.:..:..:::.|:..|..: |.......|| :....||:..|...:|.. ..:|..:.||.
Mosquito     6 YTYPENFRAYKVLIAAQYSGTPV-KVAADFVFGETNCSEPFLQKFPSGKVPAYETKDGKYLTESN 69

  Fly    67 AIAVYLVEKY--GKDDSLFPNDPQKRALINQRLYFDMGTLHDSFMKYYYPFIRTG----QLGNAE 125
            |||.|:..:.  |.:|.       .||.:...|.|....|..:...:.:|.|  |    ...|.|
Mosquito    70 AIAYYVANEQLRGANDF-------HRAEVQSFLSFADNVLLPAVQGWTFPMI--GIVPYNKNNVE 125

  Fly   126 NYK-KVEAAFEFLDIFLEGQDYVAGSQLTVADIAILSS-VSTFEVVEFDISKYP--NVARWY 183
            ..| ::......|:..|..|.|:.|.::|:||:.:.:: :..:|.|.....:.|  .|.||:
Mosquito   126 RAKEELRRGLAALNSRLLKQTYLVGERITLADVVVFATLLHAYEYVLDPAFRAPFGAVNRWF 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 45/192 (23%)
GST_N_Delta_Epsilon 1..74 CDD:239343 18/71 (25%)
GST_C_Delta_Epsilon 88..204 CDD:198287 25/104 (24%)
AgaP_AGAP000883XP_316859.4 GST_N_EF1Bgamma 3..78 CDD:239342 18/72 (25%)
GstA 4..201 CDD:223698 45/192 (23%)
GST_C_EF1Bgamma_like 88..209 CDD:198290 25/102 (25%)
EF1G 267..372 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.