DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and GSTD3

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:XP_313667.3 Gene:GSTD3 / 1274529 VectorBaseID:AGAP004382 Length:210 Species:Anopheles gambiae


Alignment Length:211 Identity:86/211 - (40%)
Similarity:127/211 - (60%) Gaps:2/211 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFYYSPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWES 65
            ||:|||..|...::.|:|||.||:.||.|:..:.:... :....|||||||||||||||..:|||
Mosquito     1 MDYYYSLISPPCQSAILVAKKLGITLNLKKTNVHDPVE-RDALTKLNPQHTIPTLVDNGHVVWES 64

  Fly    66 RAIAVYLVEKYGKDDSLFPNDPQKRALINQRLYFDMGTLHDSFMKYYYPFIRTGQLGNAENYKKV 130
            .||..||||.|||||:|:|.||:.|:::||||:||:|||:...:...:..::..| ...|..:|:
Mosquito    65 YAIVTYLVEVYGKDDTLYPKDPKVRSVVNQRLFFDIGTLYKQIIDIIHLVVKKEQ-PTDEQMEKL 128

  Fly   131 EAAFEFLDIFLEGQDYVAGSQLTVADIAILSSVSTFEVVEFDISKYPNVARWYANAKKITPGWDE 195
            :.|.:.|:.||..:.|.|...||||||.:|.||:....:::|:..:|::..|.|......|.:.|
Mosquito   129 KKAMDLLEHFLTERSYAAADHLTVADICLLGSVTALNWLKYDLEPFPHIKGWVARVTGEIPDYAE 193

  Fly   196 NWKGLLQMKTMYEAQK 211
            ..|.:.:....|.|.|
Mosquito   194 FRKDVEEATKAYVASK 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 79/182 (43%)
GST_N_Delta_Epsilon 1..74 CDD:239343 37/72 (51%)
GST_C_Delta_Epsilon 88..204 CDD:198287 35/115 (30%)
GSTD3XP_313667.3 GstA 1..204 CDD:223698 83/204 (41%)
GST_N_Delta_Epsilon 1..73 CDD:239343 37/72 (51%)
GST_C_Delta_Epsilon 87..201 CDD:198287 35/114 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46822
OrthoDB 1 1.010 - - D113221at6960
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43969
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
TreeFam 1 0.960 - -
87.890

Return to query results.
Submit another query.