DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and AgaP_AGAP004172

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:XP_313058.1 Gene:AgaP_AGAP004172 / 1273994 VectorBaseID:AGAP004172 Length:216 Species:Anopheles gambiae


Alignment Length:216 Identity:79/216 - (36%)
Similarity:119/216 - (55%) Gaps:17/216 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFYYSPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWES 65
            ||.||:..|..||.|:::.:||.|:.|...|.:...:::.|.|.|:|||||:||||.:|.||.|.
Mosquito     1 MDLYYNILSPPSRAILLLGEALQLKFNLISLDVHRKDYVNPAFKKINPQHTVPTLVVDGVAICEP 65

  Fly    66 RAIAVYLVEKYG-KDDSLFPNDPQKRALINQRLYFDMGTLHDSFMKYYYPFIRTGQLGNAENYKK 129
            .||.:||.|:|. ...:.:|.||.:||::||||.|:.|||:.....||.|.:.........:.:|
Mosquito    66 GAILIYLAEQYAPAGTTYYPPDPLRRAIVNQRLLFECGTLYKCIFVYYSPVVLERATPVETDRQK 130

  Fly   130 VEAAFEFLDIFLEGQDYVAGSQLTVADIAILSSVSTFEVVEFDISKYPNVARWYANAKKITPGW- 193
            :..|...||..|:...:|||..|||||.:::.:||...|::|:::.|..|.|||...|::..|: 
Mosquito   131 LIEAVAVLDGILQHSAFVAGDCLTVADYSLVCTVSMLVVLKFELAPYAAVRRWYERCKEVIAGYT 195

  Fly   194 ---------------DENWKG 199
                           .||.||
Mosquito   196 DLTQRAVTMFQKWMEQENSKG 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 72/183 (39%)
GST_N_Delta_Epsilon 1..74 CDD:239343 33/72 (46%)
GST_C_Delta_Epsilon 88..204 CDD:198287 41/128 (32%)
AgaP_AGAP004172XP_313058.1 GstA 1..189 CDD:223698 73/187 (39%)
GST_N_Delta_Epsilon 1..74 CDD:239343 33/72 (46%)
GST_C_Delta_Epsilon 89..206 CDD:198287 37/116 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46822
OrthoDB 1 1.010 - - D113221at6960
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43969
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
TreeFam 1 0.960 - -
87.890

Return to query results.
Submit another query.