DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and GST1D_ANOGA

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:XP_313048.1 Gene:GST1D_ANOGA / 1273988 VectorBaseID:AGAP004164 Length:216 Species:Anopheles gambiae


Alignment Length:203 Identity:114/203 - (56%)
Similarity:144/203 - (70%) Gaps:6/203 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFYYSPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWES 65
            |||||.|.|:..|.:.|.|.|:|:|||.|...:.:|||:|||||||||||.:|||||||||:|||
Mosquito     1 MDFYYLPGSAPCRAVQMTAAAVGVELNLKLTDLMKGEHMKPEFLKLNPQHCVPTLVDNGFALWES 65

  Fly    66 RAIAVYLVEKYGK---DDSLFPNDPQKRALINQRLYFDMGTLHDSFMKYYYPFIRTGQLGNAENY 127
            |||..||||||||   :|||:|.||||||::|||||||||||:..|..||||.|..|...|..|:
Mosquito    66 RAIMCYLVEKYGKPCNNDSLYPTDPQKRAIVNQRLYFDMGTLYQRFGDYYYPQIFEGAPANETNF 130

  Fly   128 KKVEAAFEFLDIFLEGQDYVAGSQ-LTVADIAILSSVSTFEVVEFDISKYPNVARWYANAKKITP 191
            .|:..|..|||.||||:.:|||.. .::|||::.::::||||..:|.|.|.||.|||.:..::.|
Mosquito   131 AKIGEALAFLDTFLEGERFVAGGNGYSLADISLYATLTTFEVAGYDFSAYVNVLRWYKSMPELIP 195

  Fly   192 GWDEN--W 197
            ..|.|  |
Mosquito   196 ASDTNRSW 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 109/186 (59%)
GST_N_Delta_Epsilon 1..74 CDD:239343 47/72 (65%)
GST_C_Delta_Epsilon 88..204 CDD:198287 55/113 (49%)
GST1D_ANOGAXP_313048.1 GstA 1..207 CDD:223698 114/203 (56%)
GST_N_Delta_Epsilon 1..74 CDD:239343 47/72 (65%)
GST_C_Delta_Epsilon 91..208 CDD:198287 55/113 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46822
OrthoDB 1 1.010 - - D113221at6960
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm9614
Panther 1 1.100 - - O PTHR43969
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
TreeFam 00.000 Not matched by this tool.
77.030

Return to query results.
Submit another query.