DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and GSTO2

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_899062.1 Gene:GSTO2 / 119391 HGNCID:23064 Length:243 Species:Homo sapiens


Alignment Length:213 Identity:51/213 - (23%)
Similarity:91/213 - (42%) Gaps:28/213 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YSPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPE-FLKLNPQHTIPTL-VDNGFAIWESRA 67
            :.|.|..:| :::.||.:..|:....||      .||| :...:|...||.| ......|:||..
Human    31 FCPYSHRTR-LVLKAKDIRHEVVNINLR------NKPEWYYTKHPFGHIPVLETSQCQLIYESVI 88

  Fly    68 IAVYLVEKY-GKDDSLFPNDPQKRALINQRLYFDMGTLHDSFMKYYYPFIRTGQLGNAENYK-KV 130
            ...||.:.| |:  .|||.||.:||  .|::..::........|.....:|.|:  ...|.| .:
Human    89 ACEYLDDAYPGR--KLFPYDPYERA--RQKMLLELFCKVPHLTKECLVALRCGR--ECTNLKAAL 147

  Fly   131 EAAFEFLDIFLEGQD--YVAGSQLTVADIAI---LSSVSTFEVVEFDISKYPNVARWYANAKKIT 190
            ...|..|:..||.|:  :..|:.:::.|..:   ...:..:.:::. :|..|.:..|.:..|   
Human   148 RQEFSNLEEILEYQNTTFFGGTCISMIDYLLWPWFERLDVYGILDC-VSHTPALRLWISAMK--- 208

  Fly   191 PGWDENWKGLLQMKTMYE 208
              ||.....||..|::::
Human   209 --WDPTVCALLMDKSIFQ 224

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 45/187 (24%)
GST_N_Delta_Epsilon 1..74 CDD:239343 20/70 (29%)
GST_C_Delta_Epsilon 88..204 CDD:198287 23/121 (19%)
GSTO2NP_899062.1 Thioredoxin_like 7..94 CDD:320948 19/69 (28%)