DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and Gsto1

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001007603.1 Gene:Gsto1 / 114846 RGDID:70952 Length:241 Species:Rattus norvegicus


Alignment Length:203 Identity:56/203 - (27%)
Similarity:89/203 - (43%) Gaps:40/203 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YSPR--SSGSRTIIMVAKALG-----LELNKKQLRITEGEHLKPE-FLKLNPQHTIPTLVD-NGF 60
            ||.|  ....|| :||.||.|     :.:|.|.         ||| |.:.||...:|.|.: .|.
  Rat    27 YSMRFCPFAQRT-LMVLKAKGIRHEIININLKN---------KPEWFFEKNPFGLVPVLENTQGH 81

  Fly    61 AIWESRAIAVYLVEKYGKDDSLFPNDPQKRALINQRLYFDM----GTLHDSFM----KYYYPFIR 117
            .|.||.....||.|.| .:..|||:||.::|.  |::.|::    .:|..||:    |..:|.|:
  Rat    82 LITESVITCEYLDEAY-PEKKLFPDDPYEKAC--QKMTFELFSKVPSLVTSFIRAKRKEDHPGIK 143

  Fly   118 TGQLGNAENYKKVEAAFEFLDIFLEGQDYVAGSQLTVADIAILSSVSTFEVVEFD--ISKYPNVA 180
            . :|  .:.:.|:|.|     :..:...:..|:.|::.|..|.......|.:|.:  |...|.:.
  Rat   144 E-EL--KKEFSKLEEA-----MAKKRTAFFGGNSLSMIDYLIWPWFQRLEALELNECIDHTPKLK 200

  Fly   181 RWYANAKK 188
            .|.|..::
  Rat   201 LWMATMQE 208

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 55/197 (28%)
GST_N_Delta_Epsilon 1..74 CDD:239343 26/77 (34%)
GST_C_Delta_Epsilon 88..204 CDD:198287 23/111 (21%)
Gsto1NP_001007603.1 GST_N_Omega 5..94 CDD:239353 25/76 (33%)
GstA 26..214 CDD:223698 56/203 (28%)