DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and Clic5

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_446055.1 Gene:Clic5 / 94272 RGDID:620659 Length:251 Species:Rattus norvegicus


Alignment Length:204 Identity:44/204 - (21%)
Similarity:71/204 - (34%) Gaps:67/204 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDALYPKDI 71
            |:.||   :.|:..::...|...:.|....|.|..||....:...|..:|      ::.|.|:  
  Rat    46 GVVFN---VTTVDLKRKPADLHNLAPGTHPPFLTFNGDVKTDVNKIEEFL------EETLTPE-- 99

  Fly    72 QKQAVINQRLYFDMALMYPTLANYYYKAFTTG--QFGSEEDY-----------------KKVQET 117
                            .||.||..:.::.|.|  .|.....|                 |.:::.
  Rat   100 ----------------KYPKLAARHRESNTAGIDIFSKFSAYIKNTKQQNNAALERGLTKALRKL 148

  Fly   118 FDFLNTFL--------EGQD------YVAGDQYTVADIAILANVSNFDVVGFDISKYPNVARWYD 168
            .|:|||.|        .|.:      ::.||:.|:||..:|..:   .||.....||.|    ||
  Rat   149 DDYLNTPLPEEIDTNTHGDEKGSQRKFLDGDELTLADCNLLPKL---HVVKIVAKKYRN----YD 206

  Fly   169 HVKKITPGW 177
            ...::|..|
  Rat   207 IPAEMTGLW 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 12/50 (24%)
GstA 6..173 CDD:223698 42/198 (21%)
GST_C_Delta_Epsilon 72..188 CDD:198287 30/139 (22%)
Clic5NP_446055.1 Required for insertion into the membrane. /evidence=ECO:0000250 1..98 13/60 (22%)
O-ClC 14..249 CDD:129941 44/204 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348230
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.