Sequence 1: | NP_788656.1 | Gene: | GstD3 / 48336 | FlyBaseID: | FBgn0010039 | Length: | 199 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_004660.2 | Gene: | CLIC3 / 9022 | HGNCID: | 2064 | Length: | 236 | Species: | Homo sapiens |
Alignment Length: | 200 | Identity: | 37/200 - (18%) |
---|---|---|---|
Similarity: | 71/200 - (35%) | Gaps: | 66/200 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 GLEFNKKIINTLKGEQMNPDFIK-INPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDALYPKD 70
Fly 71 IQKQAVINQRLYFDMALMYPTLANYYYKAFTTG-----QFGS----------EEDYKKVQETFDF 120
Fly 121 LNTFLEG----------------QDYVAGDQYTVADIAILANVSNFDVVGFDISKYP------NV 163
Fly 164 ARWYD 168 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD3 | NP_788656.1 | GST_N_Delta_Epsilon | <1..58 | CDD:239343 | 11/51 (22%) |
GstA | 6..173 | CDD:223698 | 36/199 (18%) | ||
GST_C_Delta_Epsilon | 72..188 | CDD:198287 | 22/133 (17%) | ||
CLIC3 | NP_004660.2 | Required for insertion into the membrane. /evidence=ECO:0000250 | 1..88 | 12/55 (22%) | |
PLN02817 | 5..229 | CDD:330276 | 36/199 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165154446 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |