DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and CLIC3

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_004660.2 Gene:CLIC3 / 9022 HGNCID:2064 Length:236 Species:Homo sapiens


Alignment Length:200 Identity:37/200 - (18%)
Similarity:71/200 - (35%) Gaps:66/200 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GLEFNKKIINTLKGEQMNPDFIK-INPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDALYPKD 70
            |:.|....::|    :.:||.:| ..|...:|.|:.:.....::..|..:|.|..|..|      
Human    36 GVPFTLTTVDT----RRSPDVLKDFAPGSQLPILLYDSDAKTDTLQIEDFLEETLGPPD------ 90

  Fly    71 IQKQAVINQRLYFDMALMYPTLANYYYKAFTTG-----QFGS----------EEDYKKVQETFDF 120
                              :|:||..|.::.|.|     :|.:          |..|:::......
Human    91 ------------------FPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRALAR 137

  Fly   121 LNTFLEG----------------QDYVAGDQYTVADIAILANVSNFDVVGFDISKYP------NV 163
            |:::|..                :.::.||:.|:||.::|..:...|.|.....:.|      .|
Human   138 LDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGV 202

  Fly   164 ARWYD 168
            .|:.|
Human   203 RRYLD 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 11/51 (22%)
GstA 6..173 CDD:223698 36/199 (18%)
GST_C_Delta_Epsilon 72..188 CDD:198287 22/133 (17%)
CLIC3NP_004660.2 Required for insertion into the membrane. /evidence=ECO:0000250 1..88 12/55 (22%)
PLN02817 5..229 CDD:330276 36/199 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154446
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.