DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and CAM1

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_015277.1 Gene:CAM1 / 856059 SGDID:S000005969 Length:415 Species:Saccharomyces cerevisiae


Alignment Length:225 Identity:53/225 - (23%)
Similarity:91/225 - (40%) Gaps:47/225 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KALGLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLV-DNGFTIWESRAILVYLVEKYGKDDALY 67
            |||.|:. |.:......||...||    |...:|..| ..|:.:.|:.||..||| |..:||.:.
Yeast    22 KALKLDV-KVVTPDAAAEQFARDF----PLKKVPAFVGPKGYKLTEAMAINYYLV-KLSQDDKMK 80

  Fly    68 PK------DIQKQAVI-------NQRLYFDMALMYPTL---ANYYYKAFTTGQFGSEEDYKKVQE 116
            .:      |:..||.|       |..|...:|.....|   |.|..|:..:..       ..|.:
Yeast    81 TQLLGADDDLNAQAQIIRWQSLANSDLCIQIANTIVPLKGGAPYNKKSVDSAM-------DAVDK 138

  Fly   117 TFDFLNTFLEGQDYVAGDQYTVADIAILANVSNF--DVVGFD-ISKYPNVARWYDHVKKITPGWE 178
            ..|.....|:...|:|.:..::||:...:..:.:  .:.|.: .:::|.:.||::.| :.:|..:
Yeast   139 IVDIFENRLKNYTYLATENISLADLVAASIFTRYFESLFGTEWRAQHPAIVRWFNTV-RASPFLK 202

  Fly   179 ENWAGALDVK----------KRIEEKQNAA 198
            :.:.   |.|          |:.|:|..||
Yeast   203 DEYK---DFKFADKPLSPPQKKKEKKAPAA 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 18/54 (33%)
GstA 6..173 CDD:223698 43/186 (23%)
GST_C_Delta_Epsilon 72..188 CDD:198287 24/128 (19%)
CAM1NP_015277.1 GST_N_EF1Bgamma 4..73 CDD:239342 19/56 (34%)
GST_C_EF1Bgamma_like 92..214 CDD:198290 25/132 (19%)
EF1G 255..359 CDD:395522
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345065
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.