DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and GTT1

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_012304.1 Gene:GTT1 / 854856 SGDID:S000001477 Length:234 Species:Saccharomyces cerevisiae


Alignment Length:220 Identity:45/220 - (20%)
Similarity:82/220 - (37%) Gaps:82/220 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PDFIKINPQHSIPTL-VDNGFT-----IWESRAILVYLVEKYGKDDALYPKDIQKQAVINQRLYF 83
            |:..||:|....|.| |.:..|     :.||..|..|:::.:.....|..:|......||..|::
Yeast    45 PELKKIHPLGRSPLLEVQDRETGKKKILAESGFIFQYVLQHFDHSHVLMSEDADIADQINYYLFY 109

  Fly    84 -------------------DMALMYP------TLANYYYKAFTTGQFGSEEDYKKVQETFDFLNT 123
                               |..:.:|      .:|:...:|:::|:         |:..||    
Yeast   110 VEGSLQPPLMIEFILSKVKDSGMPFPISYLARKVADKISQAYSSGE---------VKNQFD---- 161

  Fly   124 FLEGQ-----DYVAGDQYTVADIAILANVSNFDVVGFDI-----------SKYPNVARWYDHVKK 172
            |:||:     .|:...:.:.|||          ::.|.:           ..||.:::|   :|.
Yeast   162 FVEGEISKNNGYLVDGKLSGADI----------LMSFPLQMAFERKFAAPEDYPAISKW---LKT 213

  Fly   173 ITPGWEENWAGALDVKKRIEEKQNA 197
            ||.  ||::|.:       :||..|
Yeast   214 ITS--EESYAAS-------KEKARA 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 12/38 (32%)
GstA 6..173 CDD:223698 37/194 (19%)
GST_C_Delta_Epsilon 72..188 CDD:198287 28/156 (18%)
GTT1NP_012304.1 GST_N_GTT1_like 6..87 CDD:239344 12/41 (29%)
GST_C_GTT1_like 93..218 CDD:198298 26/152 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.