DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and GTT2

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_013040.1 Gene:GTT2 / 850666 SGDID:S000003983 Length:233 Species:Saccharomyces cerevisiae


Alignment Length:198 Identity:49/198 - (24%)
Similarity:86/198 - (43%) Gaps:29/198 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 INTLKGEQMNPDFIKINPQHSIPTL-VDNGFTIWESRAILVYLVEKYGKDDALYPKDIQKQAV-- 76
            ||..|||...|:|:..|...::|.| :|:|..|.|..||..|:....|.........::|..:  
Yeast    51 INLWKGEHKKPEFLAKNYSGTVPVLELDDGTLIAECTAITEYIDALDGTPTLTGKTPLEKGVIHM 115

  Fly    77 INQRLYFDMALMYPTLANYYYKAFTTGQFGSEEDYK----------KVQETFDFLNTFLEGQDYV 131
            :|:|.  ::.|:.|  .:.|:...|.|.....|.|:          |......:.:|.|..:.||
Yeast   116 MNKRA--ELELLDP--VSVYFHHATPGLGPEVELYQNKEWGLRQRDKALHGMHYFDTVLRERPYV 176

  Fly   132 AGDQYTVADIAILANVSNFDVVGFDISKYPNVAR-WYDHVKKITPGWEENWAGALDVKKRIEEKQ 195
            |||.:::|||.::|.:....:|...:.:.....| ||..::: .|          .|||.:|.:.
Yeast   177 AGDSFSMADITVIAGLIFAAIVKLQVPEECEALRAWYKRMQQ-RP----------SVKKLLEIRS 230

  Fly   196 NAA 198
            .::
Yeast   231 KSS 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 17/43 (40%)
GstA 6..173 CDD:223698 44/171 (26%)
GST_C_Delta_Epsilon 72..188 CDD:198287 27/128 (21%)
GTT2NP_013040.1 GST_N_GTT2_like 19..94 CDD:239349 17/42 (40%)
GST_C_GTT2_like 106..222 CDD:198291 27/130 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345140
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.