DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and GSTF14

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_175408.1 Gene:GSTF14 / 841409 AraportID:AT1G49860 Length:254 Species:Arabidopsis thaliana


Alignment Length:187 Identity:52/187 - (27%)
Similarity:87/187 - (46%) Gaps:19/187 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GLEFNKKIINTLKGEQMNPDFIK-INPQHSIPTLVDNGFTIWESRAILVYLVEKYGKD--DALYP 68
            ||:|....::.|.||.....|:. :||...:|.|.|....::|.:||..||.|:| ||  ..|.|
plant    27 GLDFELVFVDWLAGEAKTKTFLSTLNPFGEVPVLEDGDLKLFEPKAITRYLAEQY-KDVGTNLLP 90

  Fly    69 KDIQKQAVINQRLYFDMALMYPTLANYY-------YKAFTTGQFGSEEDYKKVQETFDFLNTFLE 126
            .|.:|:|:::..:..|.....|..:...       |:...|.....:|:.:|:.|..:...|.|.
plant    91 DDPKKRAIMSMWMEVDSNQFLPIASTLIKELIINPYQGLATDDTAVQENKEKLSEVLNIYETRLG 155

  Fly   127 GQDYVAGDQYTVADIAILA------NVSNFDVVGFDISKYPNVARWYDHVKKITPGW 177
            ...|:||:.:::||:..||      |....::.....|: ||||.|.:.: |:.|.|
plant   156 ESPYLAGESFSLADLHHLAPIDYLLNTDEEELKNLIYSR-PNVAAWVEKM-KMRPAW 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 17/51 (33%)
GstA 6..173 CDD:223698 49/181 (27%)
GST_C_Delta_Epsilon 72..188 CDD:198287 28/119 (24%)
GSTF14NP_175408.1 GST_N_Phi 5..80 CDD:239351 17/52 (33%)
GST_C_Phi 94..214 CDD:198296 28/119 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.