DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and clic3

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_955818.1 Gene:clic3 / 84040 ZFINID:ZDB-GENE-010507-2 Length:239 Species:Danio rerio


Alignment Length:198 Identity:39/198 - (19%)
Similarity:65/198 - (32%) Gaps:72/198 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GLEFNKKIINTLKGEQMNPDFIK-INPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDALYPKD 70
            |:.|....::..:.    |:.:| :.|....|.|:.||....::..|..:|      :|.|.|. 
Zfish    37 GVNFTLTTVDMKRA----PEVLKDLAPGSQPPFLIYNGEVRTDTNKIEEFL------EDTLAPP- 90

  Fly    71 IQKQAVINQRLYFDMALMYPTLANYYYKAFTTGQ--FGSEEDY-------------KKVQETFDF 120
                             .||.|...|.::.|.|.  |.....|             ||..::...
Zfish    91 -----------------QYPKLCCRYKESNTAGDDIFHKFSAYIKNPNPGLNDMLEKKFLKSLMK 138

  Fly   121 LNTFL----------------EGQDYVAGDQYTVADIAILANVSNFDVV-----GFDI------- 157
            |:.:|                ..:.|:.|:..::||..:|..:....||     ||:|       
Zfish   139 LDQYLLTPLPHELDQNPELSTSTRHYLDGNALSLADCNLLPKLHIVKVVCKKYRGFEIPAELKGL 203

  Fly   158 SKY 160
            |||
Zfish   204 SKY 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 11/51 (22%)
GstA 6..173 CDD:223698 39/198 (20%)
GST_C_Delta_Epsilon 72..188 CDD:198287 25/132 (19%)
clic3NP_955818.1 GST_N_CLIC 3..92 CDD:239359 14/82 (17%)
O-ClC 6..237 CDD:129941 39/198 (20%)
GST_C_CLIC3 99..231 CDD:198332 22/108 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589607
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.