DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and GSTF7

DIOPT Version :10

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_171791.1 Gene:GSTF7 / 839295 AraportID:AT1G02920 Length:209 Species:Arabidopsis thaliana


Alignment Length:94 Identity:21/94 - (22%)
Similarity:34/94 - (36%) Gaps:26/94 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 PTLFAFSYIIIVLGAVMMVVAMLGCCGITGRSRPFLIIYSMVVFLLLVATLSCGIYLLYKKDGLD 172
            |.| .:.|:|:||.:.:   |........|..|.||.:....|||                    
plant   127 PAL-GWQYVIVVLSSGL---AFPPLYFYNGGVREFLAMVKQHVFL-------------------- 167

  Fly   173 VELSDALNYMVQHYYQGPGVVQESLDHLQ 201
            ...|:..|..:.:.:|.|  :|.:|..|:
plant   168 ARSSEDQNVFIVNDFQSP--LQRTLSSLE 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343
GST_C_Delta_Epsilon 72..188 CDD:198287 16/79 (20%)
GSTF7NP_171791.1 GST_N_Phi 4..77 CDD:239351
GST_C_Phi 95..209 CDD:198296 21/94 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.