DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and GSTF4

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001320441.1 Gene:GSTF4 / 838240 AraportID:AT1G02950 Length:255 Species:Arabidopsis thaliana


Alignment Length:204 Identity:44/204 - (21%)
Similarity:75/204 - (36%) Gaps:38/204 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDALYPKDIQ 72
            |.:....:....||.....|:.:||...:|...|....::|||||..|:.         |....:
plant    60 LSYEPITVKLQTGEHKTEPFLSLNPFGQVPVFEDGSVKLYESRAITQYIA---------YVHSSR 115

  Fly    73 KQAVINQRLYFDMALMY-----------PTLANYYYKAFTTGQFGSEEDYKKVQET----FDFLN 122
            ...::|.|.:..||.:.           |..:...::......:|.|.|...|:|.    ...||
plant   116 GTQLLNLRSHETMATLTMWMEIEAHQFDPPASKLTWEQVIKPIYGLETDQTIVKENEAILEKVLN 180

  Fly   123 TF---LEGQDYVAGDQYTVADIAILANVSNFDVVGFD----ISKYPNVARWYDHVKKITPGWEEN 180
            .:   ||...::|.:.:|:.|:..|.|:..  ::|..    ..|...|.:|.|.:..     .|.
plant   181 IYEKRLEESRFLACNSFTLVDLHHLPNIQY--LLGTPTKKLFEKRSKVRKWVDEITS-----REA 238

  Fly   181 WAGALDVKK 189
            |..|.|.:|
plant   239 WKMACDQEK 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 14/49 (29%)
GstA 6..173 CDD:223698 39/186 (21%)
GST_C_Delta_Epsilon 72..188 CDD:198287 28/137 (20%)
GSTF4NP_001320441.1 GST_N_Phi 38..109 CDD:239351 14/48 (29%)
GST_C_Phi 126..243 CDD:198296 24/123 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.