DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and GSTF12

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_197224.1 Gene:GSTF12 / 831586 AraportID:AT5G17220 Length:214 Species:Arabidopsis thaliana


Alignment Length:194 Identity:47/194 - (24%)
Similarity:85/194 - (43%) Gaps:32/194 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDA-LYPKD 70
            |:||....|:....||..|:.:...|...:|.:.|..|.::|||||..|...|:..... |..|.
plant    25 GIEFEIIHIDLDTFEQKKPEHLLRQPFGQVPAIEDGDFKLFESRAIARYYATKFADQGTNLLGKS 89

  Fly    71 IQKQAVINQ----RLYFDMALMYPTLANYYYKAFTTGQFGSE------EDYK-KVQETFDFLNTF 124
            ::.:|:::|    ..|:...|..|.:.|...|.    :.|.:      ||.| |:....|..|..
plant    90 LEHRAIVDQWADVETYYFNVLAQPLVINLIIKP----RLGEKCDVVLVEDLKVKLGVVLDIYNNR 150

  Fly   125 LEGQDYVAGDQYTVADIAILANVSNFDVVGF-----DISKYPNVA----RWYDHVKKITPGWEE 179
            |....::||:::|:||:      ::...:|:     ||::.....    ||::.:.. .|.|::
plant   151 LSSNRFLAGEEFTMADL------THMPAMGYLMSITDINQMVKARGSFNRWWEEISD-RPSWKK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 17/50 (34%)
GstA 6..173 CDD:223698 45/186 (24%)
GST_C_Delta_Epsilon 72..188 CDD:198287 27/128 (21%)
GSTF12NP_197224.1 PLN02473 1..214 CDD:166114 47/194 (24%)
GST_N_Phi 2..77 CDD:239351 17/51 (33%)
GST_C_Phi 91..209 CDD:198296 27/128 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.